PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00007.1.g10010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 701aa    MW: 72889.4 Da    PI: 6.3382
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00007.1.g10010.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS262.61.4e-803427003374
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   + L ++A+a ++g+ + a+++Larl+++  p g+p+ R a+y++eAL a   +      +   ++ t++ +++ +laa+k 
  Zjn_sc00007.1.g10010.1.am.mk 342 DELAAAAKATEAGNSTGAREILARLNHQLPPFGKPFLRSASYLKEALLALAEGR----HHHGGSRLTTPLDVALKLAAYKS 418
                                   7899********************************************999993....33345566666779********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRp....egppslRiTgvgspesgskeel 158
                                   fs++sP+l+f+++ta qa+l++++++  +++H+iDfd++ G+QW+++lq+La R+    +  p +++ +++s++s++  el
  Zjn_sc00007.1.g10010.1.am.mk 419 FSDLSPVLQFTNFTATQALLDEIASSsaSCIHVIDFDLGVGGQWASFLQELAHRRcaggATMPFVKLSAFVSAASHHPLEL 499
                                   **********************99987899***********************9998666689****************** PP

                          GRAS 159 eetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkv 238
                                   +  ++++++fA  lg+pfefn++   +++++++ eL   + +E++aV+l +          +     +++L+lvk+l Pkv
  Zjn_sc00007.1.g10010.1.am.mk 500 RLAKDNISQFAGDLGIPFEFNAI---SVDAFNPAELISPTgDEVIAVSLPVGCSARA---PP----LPAILRLVKQLGPKV 570
                                   **********************9...8999***9*9666689********9777665...44....556************ PP

                          GRAS 239 vvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerl 319
                                   vv +++  d+ + +F ++ l++++ ++ l+dsl+a+ + +++ ++k+E++l++++i++ v  + ++      + + Wr+++
  Zjn_sc00007.1.g10010.1.am.mk 571 VVAIDHGGDRADLPFSQHYLNCFQSCVFLLDSLDAS-GIDADSASKIEKFLIQPRIEDTVIGRCKS-----DKPMAWRSAF 645
                                   *********************************999.8999*******************988887.....78999***** PP

                          GRAS 320 eeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                    +aGF pv+ s  a++qa++ll++v+++g++ve+    l+l+W++ +Lv+vSaWr
  Zjn_sc00007.1.g10010.1.am.mk 646 AAAGFAPVSPSILAEAQADCLLKRVQVRGFHVEKCGVGLTLYWQRGELVTVSAWR 700
                                   ******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.631314680IPR005202Transcription factor GRAS
PfamPF035144.7E-78342700IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MRAALFGAER NGAADLVGGG KALVEPRSVL DCTRSPSPNN STSTLSSSLG GGAADSAGGV  60
AAVSDNSAAA AKRGAPGEHG GGGGGGKEDW AGGCDLPPIP SGLDMGLVGG DGWDAVLGSA  120
AAAGQDQTFL NWIIGAAGDL DQPGPTLQVH NQPLLDNAGF GFPATDPLGF SLEPHLGGVA  180
SDLSSPGAVS HTSNSGGGSK ASSSFGLFSP ESASLQPTPP PMLFHEGIDT KPPLLAAQPP  240
GLLHQYQHHP PPPASTFFMP LPSFTDHNQQ PPLLQPPPKR HPSMADDLYH ARNRLPSAAA  300
AQGLPFPPIH GPAPFQFHPS PTVPHGAMKS TVAEAAQQQL LDELAAAAKA TEAGNSTGAR  360
EILARLNHQL PPFGKPFLRS ASYLKEALLA LAEGRHHHGG SRLTTPLDVA LKLAAYKSFS  420
DLSPVLQFTN FTATQALLDE IASSSASCIH VIDFDLGVGG QWASFLQELA HRRCAGGATM  480
PFVKLSAFVS AASHHPLELR LAKDNISQFA GDLGIPFEFN AISVDAFNPA ELISPTGDEV  540
IAVSLPVGCS ARAPPLPAIL RLVKQLGPKV VVAIDHGGDR ADLPFSQHYL NCFQSCVFLL  600
DSLDASGIDA DSASKIEKFL IQPRIEDTVI GRCKSDKPMA WRSAFAAAGF APVSPSILAE  660
AQADCLLKRV QVRGFHVEKC GVGLTLYWQR GELVTVSAWR C
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-1941670080375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012704272.10.0PREDICTED: scarecrow-like protein 27
TrEMBLK3YQG50.0K3YQG5_SETIT; Uncharacterized protein
STRINGSi016508m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20203796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.18e-83GRAS family protein